Lineage for d1jqbc1 (1jqb C:3001-3139,C:3314-3351)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 947658Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 947659Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 947780Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 947979Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
  7. 947980Species Clostridium beijerinckii [TaxId:1520] [50143] (3 PDB entries)
  8. 947983Domain d1jqbc1: 1jqb C:3001-3139,C:3314-3351 [77155]
    Other proteins in same PDB: d1jqba2, d1jqbb2, d1jqbc2, d1jqbd2
    complexed with zn; mutant

Details for d1jqbc1

PDB Entry: 1jqb (more details), 1.97 Å

PDB Description: alcohol dehydrogenase from clostridium beijerinckii: crystal structure of mutant with enhanced thermal stability
PDB Compounds: (C:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1jqbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqbc1 b.35.1.2 (C:3001-3139,C:3314-3351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil

SCOPe Domain Coordinates for d1jqbc1:

Click to download the PDB-style file with coordinates for d1jqbc1.
(The format of our PDB-style files is described here.)

Timeline for d1jqbc1: