Lineage for d1j6ua3 (1j6u A:89-295)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 320172Fold c.72: Ribokinase-like [53612] (2 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 320247Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
    has extra strand located between strands 1 and 2
  5. 320248Family c.72.2.1: MurCDEF [53624] (4 proteins)
  6. 320253Protein UDP-N-acetylmuramate-alanine ligase MurC [82520] (2 species)
  7. 320263Species Thermotoga maritima [TaxId:243274] [82521] (1 PDB entry)
    TM0231
  8. 320264Domain d1j6ua3: 1j6u A:89-295 [77096]
    Other proteins in same PDB: d1j6ua1, d1j6ua2
    structural genomics
    complexed with mse

Details for d1j6ua3

PDB Entry: 1j6u (more details), 2.3 Å

PDB Description: crystal structure of udp-n-acetylmuramate-alanine ligase murc (tm0231) from thermotoga maritima at 2.3 a resolution

SCOP Domain Sequences for d1j6ua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6ua3 c.72.2.1 (A:89-295) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima}
rlhyfrdtlkrekkeefavtgtdgkttttamvahvlkhlrksptvflggimdslehgnye
kgngpvvyeldeseeffsefspnyliitnargdhlenygnsltryrsafekisrntdlvv
tfaedeltshlgdvtfgvkkgtytlemrsasraeqkamvekngkrylelklkvpgfhnvl
nalavialfdslgydlapvlealeefr

SCOP Domain Coordinates for d1j6ua3:

Click to download the PDB-style file with coordinates for d1j6ua3.
(The format of our PDB-style files is described here.)

Timeline for d1j6ua3: