Lineage for d1j6ua2 (1j6u A:296-446)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317854Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 317855Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families) (S)
  5. 317856Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. 317861Protein UDP-N-acetylmuramate-alanine ligase MurC [82452] (2 species)
  7. 317871Species Thermotoga maritima [TaxId:243274] [82453] (1 PDB entry)
    TM0231
  8. 317872Domain d1j6ua2: 1j6u A:296-446 [77095]
    Other proteins in same PDB: d1j6ua1, d1j6ua3
    structural genomics
    complexed with mse

Details for d1j6ua2

PDB Entry: 1j6u (more details), 2.3 Å

PDB Description: crystal structure of udp-n-acetylmuramate-alanine ligase murc (tm0231) from thermotoga maritima at 2.3 a resolution

SCOP Domain Sequences for d1j6ua2:

Sequence, based on SEQRES records: (download)

>d1j6ua2 c.59.1.1 (A:296-446) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima}
gvhrrfsiafhdpetniyviddyahtpdeirnllqtakevfenekivvifqphrysrler
edgnfakalqladevvvtevydafeekkngisgkmiwdslkslgkeayfveklpelekvi
svsentvflfvgagdiiyssrrfveryqssk

Sequence, based on observed residues (ATOM records): (download)

>d1j6ua2 c.59.1.1 (A:296-446) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima}
gvhrrfsiafhdpetniyviddyahtpdeirnllqtakevfenekivvifqphrgnfaka
lqladevvvtevydsgkmiwdslkslgkeayfveklpelekvisvsentvflfvgagdii
yssrrfveryqssk

SCOP Domain Coordinates for d1j6ua2:

Click to download the PDB-style file with coordinates for d1j6ua2.
(The format of our PDB-style files is described here.)

Timeline for d1j6ua2: