Lineage for d1j6ta_ (1j6t A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577808Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 2577809Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) (S)
  5. 2577810Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
    automatically mapped to Pfam PF00359
  6. 2577815Protein Phosphotransferase IIa-mannitol [55808] (1 species)
  7. 2577816Species Escherichia coli [TaxId:562] [55809] (3 PDB entries)
  8. 2577822Domain d1j6ta_: 1j6t A: [77092]
    Other proteins in same PDB: d1j6tb_

Details for d1j6ta_

PDB Entry: 1j6t (more details)

PDB Description: complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
PDB Compounds: (A:) pts system, mannitol-specific iiabc component

SCOPe Domain Sequences for d1j6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6ta_ d.112.1.1 (A:) Phosphotransferase IIa-mannitol {Escherichia coli [TaxId: 562]}
lfklgaeniflgrkaatkeeairfageqlvkggyvepeyvqamldrekltptylgesiav
phgtveakdrvlktgvvfcqypegvrfgeeeddiarlvigiaarnnehiqvitsltnald
desvierlahttsvdevlellagr

SCOPe Domain Coordinates for d1j6ta_:

Click to download the PDB-style file with coordinates for d1j6ta_.
(The format of our PDB-style files is described here.)

Timeline for d1j6ta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j6tb_