Lineage for d1j6pa2 (1j6p A:50-330)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572244Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 572414Family c.1.9.9: Hypothetical protein TM0936, probable catalytic domain [82258] (1 protein)
  6. 572415Protein Hypothetical protein TM0936, probable catalytic domain [82259] (1 species)
  7. 572416Species Thermotoga maritima [TaxId:243274] [82260] (2 PDB entries)
  8. 572418Domain d1j6pa2: 1j6p A:50-330 [77090]
    Other proteins in same PDB: d1j6pa1
    structural genomics
    complexed with mse, ni

Details for d1j6pa2

PDB Entry: 1j6p (more details), 1.9 Å

PDB Description: crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution

SCOP Domain Sequences for d1j6pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6pa2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima}
alfnththapmtllrgvaedlsfeewlfskvlpiedrltekmayygtilaqmemarhgia
gfvdmyfheewiakavrdfgmralltrglvdsngddggrleenlklynewngfegrifvg
fgphspylcseeylkrvfdtakslnapvtihlyetskeeydledilniglkevktiaahc
vhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlgtdgaasnnslnl
ffemrlasllqkaqnprnldvntclkmvtydgaqamgfksg

SCOP Domain Coordinates for d1j6pa2:

Click to download the PDB-style file with coordinates for d1j6pa2.
(The format of our PDB-style files is described here.)

Timeline for d1j6pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j6pa1