![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.9: Hypothetical protein TM0936, probable catalytic domain [82258] (1 protein) |
![]() | Protein Hypothetical protein TM0936, probable catalytic domain [82259] (1 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [82260] (2 PDB entries) |
![]() | Domain d1j6pa2: 1j6p A:50-330 [77090] Other proteins in same PDB: d1j6pa1 structural genomics complexed with mse, ni |
PDB Entry: 1j6p (more details), 1.9 Å
SCOP Domain Sequences for d1j6pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j6pa2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima} alfnththapmtllrgvaedlsfeewlfskvlpiedrltekmayygtilaqmemarhgia gfvdmyfheewiakavrdfgmralltrglvdsngddggrleenlklynewngfegrifvg fgphspylcseeylkrvfdtakslnapvtihlyetskeeydledilniglkevktiaahc vhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlgtdgaasnnslnl ffemrlasllqkaqnprnldvntclkmvtydgaqamgfksg
Timeline for d1j6pa2: