SCOPe 2.02: Domain d1j0ka1: 1j0k A:1-123

Lineage for d1j0ka1 (1j0k A:1-123)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Neopullulanase, N-terminal domain [81960] (1 species)
   homologous to maltogenic amylase

7. Species Bacillus stearothermophilus [TaxId:1422] [81961] (4 PDB entries)

8. Domain d1j0ka1: 1j0k A:1-123 [77045]
   Other proteins in same PDB: d1j0ka2, d1j0ka3, d1j0kb2, d1j0kb3

Details for d1j0ka1

PDB Entry: 1j0k, 3.2 Å

PDB Description: crystal structure of neopullulanase e357q complex with isopanose

PDB Compounds: (A:) neopullulanase

SCOPe Domain Sequences for d1j0ka1:

Sequence; same for both SEQRES and ATOM records:

>d1j0ka1 b.1.18.2 (A:1-123) Neopullulanase, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
mrkeaiyhrpadnfayaydsetlhlrlrtkkddidrvellhgdpydwqngawqfqmmpmr
ktgsdelfdywfaevkppyrrlrygfvlysgeeklvytekgfyfevptddtayyfcfpfl
hrv

Timeline for d1j0ka1:

• d1j0ka1 first appeared in SCOP 1.63
  
• d1j0ka1 appears in SCOPe 2.01
  
• d1j0ka1 appears in SCOPe 2.03
  
• d1j0ka1 appears in the current release, SCOPe 2.08