Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Neopullulanase, central domain [82240] (1 species) homologous to Maltogenic amylase |
Species Bacillus stearothermophilus [TaxId:1422] [82241] (4 PDB entries) |
Domain d1j0jb3: 1j0j B:124-505 [77044] Other proteins in same PDB: d1j0ja1, d1j0ja2, d1j0jb1, d1j0jb2 |
PDB Entry: 1j0j (more details), 2.8 Å
SCOPe Domain Sequences for d1j0jb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0jb3 c.1.8.1 (B:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} dlfeapdwvkdtvwyqifperfangnpsispegsrpwgsedptptsffggdlqgiidhld ylvdlgitgiyltpifrspsnhkydtadyfevdphfgdketlktlidrchekgirvmlda vfnhcgyefapfqdvwkngesskykdwfhihefplqteprpnydtfafvpqmpklntanp evkrylldvatywirefdidgwrldvaneidhefwrefrqevkalkpdvyilgqiwhdam pwlrgdqfdavmnypftdgvlrffakeeisarqfanqmmhvlhsypnnvneaafnllgsh dtsriltvcggdirkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpmqqn kelhqhvkqlialrkqyrslrr
Timeline for d1j0jb3: