Lineage for d1j0ja3 (1j0j A:124-505)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1145289Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1145702Protein Neopullulanase, central domain [82240] (1 species)
    homologous to Maltogenic amylase
  7. 1145703Species Bacillus stearothermophilus [TaxId:1422] [82241] (4 PDB entries)
  8. 1145708Domain d1j0ja3: 1j0j A:124-505 [77041]
    Other proteins in same PDB: d1j0ja1, d1j0ja2, d1j0jb1, d1j0jb2

Details for d1j0ja3

PDB Entry: 1j0j (more details), 2.8 Å

PDB Description: crystal structure of neopullulanase e357q complex with maltotetraose
PDB Compounds: (A:) neopullulanase

SCOPe Domain Sequences for d1j0ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ja3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]}
dlfeapdwvkdtvwyqifperfangnpsispegsrpwgsedptptsffggdlqgiidhld
ylvdlgitgiyltpifrspsnhkydtadyfevdphfgdketlktlidrchekgirvmlda
vfnhcgyefapfqdvwkngesskykdwfhihefplqteprpnydtfafvpqmpklntanp
evkrylldvatywirefdidgwrldvaneidhefwrefrqevkalkpdvyilgqiwhdam
pwlrgdqfdavmnypftdgvlrffakeeisarqfanqmmhvlhsypnnvneaafnllgsh
dtsriltvcggdirkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpmqqn
kelhqhvkqlialrkqyrslrr

SCOPe Domain Coordinates for d1j0ja3:

Click to download the PDB-style file with coordinates for d1j0ja3.
(The format of our PDB-style files is described here.)

Timeline for d1j0ja3: