Lineage for d1j09a1 (1j09 A:306-468)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003435Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2003436Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 2003437Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein)
  6. 2003438Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species)
  7. 2003439Species Thermus thermophilus [TaxId:274] [48166] (11 PDB entries)
  8. 2003440Domain d1j09a1: 1j09 A:306-468 [77025]
    Other proteins in same PDB: d1j09a2
    protein/RNA complex; complexed with atp, glu, mg

Details for d1j09a1

PDB Entry: 1j09 (more details), 1.8 Å

PDB Description: Crystal structure of Thermus thermophilus glutamyl-tRNA synthetase complexed with ATP and Glu
PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d1j09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j09a1 a.97.1.1 (A:306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef
pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv
klgqvaqplraaltgsletpglfeilallgkeralrrlerala

SCOPe Domain Coordinates for d1j09a1:

Click to download the PDB-style file with coordinates for d1j09a1.
(The format of our PDB-style files is described here.)

Timeline for d1j09a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j09a2