SCOP 1.65: Domain d1iykb1: 1iyk B:60-224

Lineage for d1iykb1 (1iyk B:60-224)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (4 families)

5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein N-myristoyl transferase, NMT [55749] (2 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)

8. Domain d1iykb1: 1iyk B:60-224 [76960]

Details for d1iykb1

PDB Entry: 1iyk, 2.3 Å

PDB Description: Crystal structure of candida albicans N-myristoyltransferase with myristoyl-COA and peptidic inhibitor

SCOP Domain Sequences for d1iykb1:

Sequence; same for both SEQRES and ATOM records:

>d1iykb1 d.108.1.2 (B:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans)}
egpidklktpedvpndplplisdfewstldiddnlqldelykllydnyvedidatfrfky
sheffqwalkppgwrkdwhvgvrvkstgklvafiaatpvtfklnksnkvidsveinflci
hkklrnkrlapvlikeitrrvnkqniwqalytggsilptplttcr

Timeline for d1iykb1:

• d1iykb1 first appeared in SCOP 1.63
  
• d1iykb1 appears in SCOP 1.67
  
• d1iykb1 appears in the current release, SCOPe 2.08