Lineage for d1ix2b_ (1ix2 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375907Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
    automatically mapped to Pfam PF04234
    automatically mapped to Pfam PF13205
  6. 2375908Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species)
  7. 2375909Species Escherichia coli [TaxId:562] [81972] (2 PDB entries)
  8. 2375911Domain d1ix2b_: 1ix2 B: [76898]

Details for d1ix2b_

PDB Entry: 1ix2 (more details), 1.55 Å

PDB Description: Crystal Structure of Selenomethionine PcoC, a Copper Resistance Protein from Escherichia coli
PDB Compounds: (B:) PcoC copper resistance protein

SCOPe Domain Sequences for d1ix2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ix2b_ b.1.18.17 (B:) Copper resistance protein C (CopC, PcoC) {Escherichia coli [TaxId: 562]}
hpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakvap
gadpksmviipreplpagtyrvdwravssdthpitgnytftvk

SCOPe Domain Coordinates for d1ix2b_:

Click to download the PDB-style file with coordinates for d1ix2b_.
(The format of our PDB-style files is described here.)

Timeline for d1ix2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ix2a_