SCOP 1.65: Domain d1iwhb_: 1iwh B:

Lineage for d1iwhb_ (1iwh B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (5 PDB entries)

8. Domain d1iwhb_: 1iwh B: [76883]
   Other proteins in same PDB: d1iwha_
   complexed with cmo, hem, pem

Details for d1iwhb_

PDB Entry: 1iwh, 1.55 Å

PDB Description: Crystal Structure of Horse Carbonmonoxyhemoglobin-Bezafibrate Complex at 1.55A Resolution: A Novel Allosteric Binding Site in R-State Hemoglobin

SCOP Domain Sequences for d1iwhb_:

Sequence; same for both SEQRES and ATOM records:

>d1iwhb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus)}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d1iwhb_:

• d1iwhb_ first appeared in SCOP 1.63
  
• d1iwhb_ appears in SCOP 1.67
  
• d1iwhb_ appears in the current release, SCOPe 2.08