Lineage for d1iwhb_ (1iwh B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687104Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries)
  8. 2687106Domain d1iwhb_: 1iwh B: [76883]
    Other proteins in same PDB: d1iwha_
    complexed with cmo, hem, pem

Details for d1iwhb_

PDB Entry: 1iwh (more details), 1.55 Å

PDB Description: Crystal Structure of Horse Carbonmonoxyhemoglobin-Bezafibrate Complex at 1.55A Resolution: A Novel Allosteric Binding Site in R-State Hemoglobin
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1iwhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iwhb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d1iwhb_:

Click to download the PDB-style file with coordinates for d1iwhb_.
(The format of our PDB-style files is described here.)

Timeline for d1iwhb_: