Lineage for d1ivsb1 (1ivs B:797-862)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760245Superfamily a.2.7: tRNA-binding arm [46589] (4 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 760262Family a.2.7.3: Valyl-tRNA synthetase (ValRS) C-terminal domain [81635] (1 protein)
  6. 760263Protein Valyl-tRNA synthetase (ValRS) C-terminal domain [81634] (1 species)
  7. 760264Species Thermus thermophilus [TaxId:274] [81633] (3 PDB entries)
  8. 760266Domain d1ivsb1: 1ivs B:797-862 [76859]
    Other proteins in same PDB: d1ivsa2, d1ivsa3, d1ivsa4, d1ivsb2, d1ivsb3, d1ivsb4
    complexed with vaa

Details for d1ivsb1

PDB Entry: 1ivs (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue
PDB Compounds: (B:) valyl-tRNA synthetase

SCOP Domain Sequences for d1ivsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivsb1 a.2.7.3 (B:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]}
dveewrrrqekrlkellalaersqrklaspgfrekapkevveaeearlkenleqaerire
alsqig

SCOP Domain Coordinates for d1ivsb1:

Click to download the PDB-style file with coordinates for d1ivsb1.
(The format of our PDB-style files is described here.)

Timeline for d1ivsb1: