| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.2: Long alpha-hairpin [46556] (11 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.7: tRNA-binding arm [46589] (4 families) ![]() formerly a class II aminoacyl-tRNA synthetase N-domain |
| Family a.2.7.3: Valyl-tRNA synthetase (ValRS) C-terminal domain [81635] (1 protein) |
| Protein Valyl-tRNA synthetase (ValRS) C-terminal domain [81634] (1 species) |
| Species Thermus thermophilus [TaxId:274] [81633] (2 PDB entries) |
| Domain d1ivsb1: 1ivs B:797-862 [76859] Other proteins in same PDB: d1ivsa2, d1ivsa3, d1ivsa4, d1ivsb2, d1ivsb3, d1ivsb4 complexed with vaa |
PDB Entry: 1ivs (more details), 2.9 Å
SCOP Domain Sequences for d1ivsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivsb1 a.2.7.3 (B:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus}
dveewrrrqekrlkellalaersqrklaspgfrekapkevveaeearlkenleqaerire
alsqig
Timeline for d1ivsb1:
View in 3DDomains from other chains: (mouse over for more information) d1ivsa1, d1ivsa2, d1ivsa3, d1ivsa4 |