Lineage for d1iv8a2 (1iv8 A:1-653)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081895Protein Maltooligosyl trehalose synthase [82242] (1 species)
    elaborated with several large insertions in the common fold
  7. 2081896Species Sulfolobus acidocaldarius [TaxId:2285] [82243] (1 PDB entry)
  8. 2081897Domain d1iv8a2: 1iv8 A:1-653 [76843]
    Other proteins in same PDB: d1iv8a1
    insertions: res. 129-189, 285-417 and 454-562

Details for d1iv8a2

PDB Entry: 1iv8 (more details), 1.9 Å

PDB Description: Crystal Structure of Maltooligosyl trehalose synthase
PDB Compounds: (A:) maltooligosyl trehalose synthase

SCOPe Domain Sequences for d1iv8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Sulfolobus acidocaldarius [TaxId: 2285]}
misatyrlqlnknfnfgdvidnlwyfkdlgvshlylspvlmaspgsnhgydvidhsrind
elggekeyrrlietahtiglgiiqdivpnhmavnslnwrlmdvlkmgkkskyytyfdffp
eddkirlpilgedldtviskgllkivkdgdeyfleyfkwklpltevgndiydtlqkqnyt
lmswknppsyrrffdvntligvnvekdhvfqeshskildldvdgyridhidglydpekyi
ndlrsiiknkiiivekilgfqeelklnsdgttgydflnysnllfnfnqeimdsiyenfta
ekisisesikkikaqiidelfsyevkrlasqlgisydilrdylscidvyrtyanqivkec
dktneieeatkrnpeaytklqqympavyakayedtflfrynrlisinevgsdlryykisp
dqfhvfnqkrrgkitlnatsthdtkfsedvrmkisvlsefpeewknkveewhsiinpkvs
rndeyryyqvlvgsfyegfsndfkerikqhmiksvreakintswrnqnkeyenrvmelve
etftnkdfiksfmkfeskirrigmikslslvalkimsagipdfyqgteiwrylltdpdnr
vpvdfkklheilekskkfeknmlesmddgrikmyltykllslrkqlaedflkg

SCOPe Domain Coordinates for d1iv8a2:

Click to download the PDB-style file with coordinates for d1iv8a2.
(The format of our PDB-style files is described here.)

Timeline for d1iv8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iv8a1