Lineage for d1iv4d_ (1iv4 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566989Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2566990Family d.79.5.1: IpsF-like [69766] (3 proteins)
    automatically mapped to Pfam PF02542
  6. 2566991Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)
  7. 2567059Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries)
  8. 2567075Domain d1iv4d_: 1iv4 D: [76837]
    complexed with c5p, mg

Details for d1iv4d_

PDB Entry: 1iv4 (more details), 1.55 Å

PDB Description: structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (bound form substrate)
PDB Compounds: (D:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1iv4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv4d_ d.79.5.1 (D:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus [TaxId: 274]}
rigygedshrleegrplylcgllipspvgalahsdgdaamhaltdallsayglgdigllf
pdtdprwrgersevflreamrlveargakllqaslvltldrpklgphrkalvdslsrlmr
lpqdrigltfktseglapshvqaravvlld

SCOPe Domain Coordinates for d1iv4d_:

Click to download the PDB-style file with coordinates for d1iv4d_.
(The format of our PDB-style files is described here.)

Timeline for d1iv4d_: