SCOP 1.75: Domain d1iv1b_: 1iv1 B:

Lineage for d1iv1b_ (1iv1 B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (1 family)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (2 proteins)

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (4 species)

7. Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries)

8. Domain d1iv1b_: 1iv1 B: [76817]

Details for d1iv1b_

PDB Entry: 1iv1, 1.65 Å

PDB Description: Structure of 2C-Methyl-D-erythritol-2,4-cyclodiphosphate Synthase

PDB Compounds: (B:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOP Domain Sequences for d1iv1b_:

Sequence; same for both SEQRES and ATOM records:

>d1iv1b_ d.79.5.1 (B:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus [TaxId: 274]}
rigygedshrleegrplylcgllipspvgalahsdgdaalhaltdallsayglgdigllf
pdtdprwrgersevflrealrlveargakllqaslvltldrpklgphrkalvdslsrllr
lpqdrigltfktseglapshvqaravvlld

Timeline for d1iv1b_:

• d1iv1b_ first appeared in SCOP 1.63
  
• d1iv1b_ appears in SCOP 1.73
  
• d1iv1b_ appears in SCOPe 2.01
  
• d1iv1b_ appears in the current release, SCOPe 2.08