Lineage for d1iv1b_ (1iv1 B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727613Superfamily d.79.5: IpsF-like [69765] (1 family) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 727614Family d.79.5.1: IpsF-like [69766] (2 proteins)
  6. 727615Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (4 species)
  7. 727660Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries)
  8. 727680Domain d1iv1b_: 1iv1 B: [76817]

Details for d1iv1b_

PDB Entry: 1iv1 (more details), 1.65 Å

PDB Description: Structure of 2C-Methyl-D-erythritol-2,4-cyclodiphosphate Synthase
PDB Compounds: (B:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOP Domain Sequences for d1iv1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv1b_ d.79.5.1 (B:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus [TaxId: 274]}
rigygedshrleegrplylcgllipspvgalahsdgdaalhaltdallsayglgdigllf
pdtdprwrgersevflrealrlveargakllqaslvltldrpklgphrkalvdslsrllr
lpqdrigltfktseglapshvqaravvlld

SCOP Domain Coordinates for d1iv1b_:

Click to download the PDB-style file with coordinates for d1iv1b_.
(The format of our PDB-style files is described here.)

Timeline for d1iv1b_: