Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (1 family) forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.5.1: IpsF-like [69766] (2 proteins) |
Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (4 species) |
Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries) |
Domain d1iv1b_: 1iv1 B: [76817] |
PDB Entry: 1iv1 (more details), 1.65 Å
SCOP Domain Sequences for d1iv1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iv1b_ d.79.5.1 (B:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus [TaxId: 274]} rigygedshrleegrplylcgllipspvgalahsdgdaalhaltdallsayglgdigllf pdtdprwrgersevflrealrlveargakllqaslvltldrpklgphrkalvdslsrllr lpqdrigltfktseglapshvqaravvlld
Timeline for d1iv1b_: