Lineage for d1iu7a1 (1iu7 A:212-628)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 556788Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 556789Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 556790Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 556791Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 556792Species Arthrobacter globiformis [TaxId:1665] [50003] (15 PDB entries)
  8. 556802Domain d1iu7a1: 1iu7 A:212-628 [76806]
    Other proteins in same PDB: d1iu7a2, d1iu7a3, d1iu7b2, d1iu7b3

Details for d1iu7a1

PDB Entry: 1iu7 (more details), 1.8 Å

PDB Description: holo form of copper-containing amine oxidase from arthrobacter globiformis

SCOP Domain Sequences for d1iu7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iu7a1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignadygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOP Domain Coordinates for d1iu7a1:

Click to download the PDB-style file with coordinates for d1iu7a1.
(The format of our PDB-style files is described here.)

Timeline for d1iu7a1: