Lineage for d1iu7b3 (1iu7 B:97-211)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599696Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 599780Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 599781Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 599782Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 599783Species Arthrobacter globiformis [TaxId:1665] [54421] (15 PDB entries)
  8. 599805Domain d1iu7b3: 1iu7 B:97-211 [76811]
    Other proteins in same PDB: d1iu7a1, d1iu7b1
    complexed with cu, tpq

Details for d1iu7b3

PDB Entry: 1iu7 (more details), 1.8 Å

PDB Description: holo form of copper-containing amine oxidase from arthrobacter globiformis

SCOP Domain Sequences for d1iu7b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iu7b3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOP Domain Coordinates for d1iu7b3:

Click to download the PDB-style file with coordinates for d1iu7b3.
(The format of our PDB-style files is described here.)

Timeline for d1iu7b3: