Lineage for d1itvb_ (1itv B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553728Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 1553729Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 1553730Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)
  6. 1553747Protein Gelatinase B (MMP-9) [82162] (1 species)
  7. 1553748Species Human (Homo sapiens) [TaxId:9606] [82163] (1 PDB entry)
  8. 1553750Domain d1itvb_: 1itv B: [76792]
    complexed with so4

Details for d1itvb_

PDB Entry: 1itv (more details), 1.95 Å

PDB Description: Dimeric form of the haemopexin domain of MMP9
PDB Compounds: (B:) mmp9

SCOPe Domain Sequences for d1itvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itvb_ b.66.1.1 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
ddacnvnifdaiaeignqlylfkdgkywrfsegrgsrpqgpfliadkwpalprkldsvfe
eplskklfffsgrqvwvytgasvlgprrldklglgadvaqvtgalrsgrgkmllfsgrrl
wrfdvkaqmvdprsasevdrmfpgvpldthdvfqfrekayfcqdrfywrvssrselnqvd
qvgyvtydilqcped

SCOPe Domain Coordinates for d1itvb_:

Click to download the PDB-style file with coordinates for d1itvb_.
(The format of our PDB-style files is described here.)

Timeline for d1itvb_: