| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.11: GARP response regulators [81683] (1 protein) plant myb-related DNA-binding motif automatically mapped to Pfam PF00249 |
| Protein Arr10-B [81684] (1 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [81685] (1 PDB entry) |
| Domain d1irza_: 1irz A: [76772] |
PDB Entry: 1irz (more details)
SCOPe Domain Sequences for d1irza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
taqkkprvlwthelhnkflaavdhlgveravpkkildlmnvdkltrenvashlqkfrval
kkvs
Timeline for d1irza_: