Class a: All alpha proteins [46456] (226 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (13 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (28 proteins) Pfam 00046 |
Protein Hepatocyte nuclear factor 1a (LFB1/HNF1) [46697] (2 species) atypical Homeodomain with a large insertion into HTH motif |
Species Human (Homo sapiens) [TaxId:9606] [81680] (1 PDB entry) |
Domain d1ic8a1: 1ic8 A:201-276 [76740] Other proteins in same PDB: d1ic8a2, d1ic8b2 |
PDB Entry: 1ic8 (more details), 2.6 Å
SCOP Domain Sequences for d1ic8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ic8a1 a.4.1.1 (A:201-276) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens)} rnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsqaqglgsnlvt evrvynwfanrrkeea
Timeline for d1ic8a1: