SCOP 1.71: Domain d1ic8a1: 1ic8 A:201-276

Lineage for d1ic8a1 (1ic8 A:201-276)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (28 proteins)
   Pfam 00046

6. Protein Hepatocyte nuclear factor 1a (LFB1/HNF1) [46697] (2 species)
   atypical Homeodomain with a large insertion into HTH motif

7. Species Human (Homo sapiens) [TaxId:9606] [81680] (1 PDB entry)

8. Domain d1ic8a1: 1ic8 A:201-276 [76740]
   Other proteins in same PDB: d1ic8a2, d1ic8b2

Details for d1ic8a1

PDB Entry: 1ic8, 2.6 Å

PDB Description: hepatocyte nuclear factor 1a bound to dna : mody3 gene product

SCOP Domain Sequences for d1ic8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ic8a1 a.4.1.1 (A:201-276) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens)}
rnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsqaqglgsnlvt
evrvynwfanrrkeea

Timeline for d1ic8a1:

• d1ic8a1 first appeared in SCOP 1.63
  
• d1ic8a1 appears in SCOP 1.69
  
• d1ic8a1 appears in SCOP 1.73
  
• d1ic8a1 appears in the current release, SCOPe 2.08