Lineage for d1h64h_ (1h64 H:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666911Fold b.38: Sm-like fold [50181] (3 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 666912Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) (S)
  5. 666913Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 666914Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 667025Species Archaeon Pyrococcus abyssi [TaxId:29292] [82089] (2 PDB entries)
  8. 667035Domain d1h64h_: 1h64 H: [76684]

Details for d1h64h_

PDB Entry: 1h64 (more details), 1.9 Å

PDB Description: crystal structure of the sm-related protein of p. abyssi the biological unit is a heptamer
PDB Compounds: (H:) snrnp sm-like protein

SCOP Domain Sequences for d1h64h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h64h_ b.38.1.1 (H:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]}
erpldvihrsldkdvlvilkkgfefrgrligydihlnvvladaemiqdgevvkrygkivi
rgdnvlaispt

SCOP Domain Coordinates for d1h64h_:

Click to download the PDB-style file with coordinates for d1h64h_.
(The format of our PDB-style files is described here.)

Timeline for d1h64h_: