Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88590] (49 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
Domain d1h3ub2: 1h3u B:342-444 [76660] Other proteins in same PDB: d1h3ua1, d1h3ub1 part of a Fc |
PDB Entry: 1h3u (more details), 2.4 Å
SCOPe Domain Sequences for d1h3ub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3ub2 b.1.1.2 (B:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls
Timeline for d1h3ub2: