![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (5 species) |
![]() | Species Thermus thermophilus [TaxId:274] [82354] (2 PDB entries) |
![]() | Domain d1h3fb1: 1h3f B:5-343 [76633] Other proteins in same PDB: d1h3fa2, d1h3fb2 complexed with so4, tyb |
PDB Entry: 1h3f (more details), 2 Å
SCOP Domain Sequences for d1h3fb1:
Sequence, based on SEQRES records: (download)
>d1h3fb1 c.26.1.1 (B:5-343) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} ghtpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrq fqelghkvvliigdftgmigdpsgrsktrppltleetrenaktyvaqagkilrqephlfe lrynsewlegltfkevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsv airadvemggtdqrfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglt eppeamfkklmrvpdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpq ippridrafyeslgyaweafgrdkeagpeevrraearyd
>d1h3fb1 c.26.1.1 (B:5-343) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]} ghtpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrq fqelghkvvliigdftgmitleetrenaktyvaqagkilrqephlfelrynsewlegltf kevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsvairadvemggtdq rfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglteppeamfkklmrv pdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpqippridrafyesl gyaweafgrdkeagpeevrraearyd
Timeline for d1h3fb1: