Lineage for d1h3fb1 (1h3f B:5-343)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105558Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)
  7. 2105595Species Thermus thermophilus [TaxId:274] [82354] (2 PDB entries)
  8. 2105597Domain d1h3fb1: 1h3f B:5-343 [76633]
    Other proteins in same PDB: d1h3fa2, d1h3fb2
    protein/RNA complex; complexed with so4, tye

Details for d1h3fb1

PDB Entry: 1h3f (more details), 2 Å

PDB Description: tyrosyl-trna synthetase from thermus thermophilus complexed with tyrosinol
PDB Compounds: (B:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1h3fb1:

Sequence, based on SEQRES records: (download)

>d1h3fb1 c.26.1.1 (B:5-343) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]}
ghtpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrq
fqelghkvvliigdftgmigdpsgrsktrppltleetrenaktyvaqagkilrqephlfe
lrynsewlegltfkevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsv
airadvemggtdqrfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglt
eppeamfkklmrvpdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpq
ippridrafyeslgyaweafgrdkeagpeevrraearyd

Sequence, based on observed residues (ATOM records): (download)

>d1h3fb1 c.26.1.1 (B:5-343) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus [TaxId: 274]}
ghtpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrq
fqelghkvvliigdftgmitleetrenaktyvaqagkilrqephlfelrynsewlegltf
kevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsvairadvemggtdq
rfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglteppeamfkklmrv
pdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpqippridrafyesl
gyaweafgrdkeagpeevrraearyd

SCOPe Domain Coordinates for d1h3fb1:

Click to download the PDB-style file with coordinates for d1h3fb1.
(The format of our PDB-style files is described here.)

Timeline for d1h3fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3fb2