Lineage for d1h3ea1 (1h3e A:6-351)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242042Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 242043Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 242044Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (11 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 242129Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (4 species)
  7. 242146Species Thermus thermophilus [TaxId:274] [82354] (2 PDB entries)
  8. 242149Domain d1h3ea1: 1h3e A:6-351 [76629]
    Other proteins in same PDB: d1h3ea2
    complexed with atp, mad, psu, rt, tyb

Details for d1h3ea1

PDB Entry: 1h3e (more details), 2.9 Å

PDB Description: tyrosyl-trna synthetase from thermus thermophilus complexed with wild- type trnatyr(gua) and with atp and tyrosinol

SCOP Domain Sequences for d1h3ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ea1 c.26.1.1 (A:6-351) Tyrosyl-tRNA synthetase (TyrRS) {Thermus thermophilus}
htpeealallkrgaeeivpeeellaklkegrpltvklgadptrpdlhlghavvlrkmrqf
qelghkvvliigdftgmigdpsgrsktrppltleetrenaktyvaqagkilrqephlfel
rynsewlegltfkevvrltslmtvaqmleredfkkryeagipislhellypfaqaydsva
iradvemggtdqrfnllvgrevqraygqspqvcflmpllvgldgrekmsksldnyiglte
ppeamfkklmrvpdpllpsyfrlltdleeeeieallkagpvpahrvlarlltaayalpqi
ppridrafyeslgyaweafgrdkeagpeevrraearydevakggip

SCOP Domain Coordinates for d1h3ea1:

Click to download the PDB-style file with coordinates for d1h3ea1.
(The format of our PDB-style files is described here.)

Timeline for d1h3ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3ea2