Lineage for d1h33a1 (1h33 A:1-150)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350824Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 350825Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 351221Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
    two-domain cytochrome c with novel domain arrangement
  6. 351222Protein Di-heme cytochrome c SoxA [81678] (1 species)
    cysteine persulfide(cys sulfane) heme coordination
  7. 351223Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (3 PDB entries)
  8. 351226Domain d1h33a1: 1h33 A:1-150 [76621]
    Other proteins in same PDB: d1h33b_

Details for d1h33a1

PDB Entry: 1h33 (more details), 1.75 Å

PDB Description: oxidised soxax complex from rhodovulum sulfidophilum

SCOP Domain Sequences for d1h33a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h33a1 a.3.1.8 (A:1-150) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum}
gpddplvingeieivtraptpahladrfdeirsgwtfrtddtqalemddfensgmvfvee
aravwdrpegtegkacadchgavddgmyglravypkyvesagkvrtveqminacrtsrmg
apewdyigpdmtamvaliasvsrgmpvsva

SCOP Domain Coordinates for d1h33a1:

Click to download the PDB-style file with coordinates for d1h33a1.
(The format of our PDB-style files is described here.)

Timeline for d1h33a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h33a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1h33b_