![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein) two-domain cytochrome c with novel domain arrangement |
![]() | Protein Di-heme cytochrome c SoxA [81678] (1 species) cysteine persulfide(cys sulfane) heme coordination |
![]() | Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (3 PDB entries) |
![]() | Domain d1h31c2: 1h31 C:151-261 [76610] Other proteins in same PDB: d1h31b_, d1h31d_, d1h31f_, d1h31h_ |
PDB Entry: 1h31 (more details), 2.55 Å
SCOP Domain Sequences for d1h31c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h31c2 a.3.1.8 (C:151-261) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum} idgpaqstwekgreiyytrygqldlscascheqyfdhyiradhlsqgqingfpsyrlkna rlnavhdrfrgcirdtrgvpfavgspefvalelyvasrgnglsvegpsvrn
Timeline for d1h31c2: