Lineage for d1h2tc1 (1h2t C:29-290)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338934Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 2338935Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
    contains three domains of this fold connected with long linkers
  7. 2338936Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)
  8. 2338952Domain d1h2tc1: 1h2t C:29-290 [76580]
    Other proteins in same PDB: d1h2tz_
    protein/RNA complex; complexed with 7mg, gdp

Details for d1h2tc1

PDB Entry: 1h2t (more details), 2.1 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg
PDB Compounds: (C:) 80 kda nuclear cap binding protein

SCOPe Domain Sequences for d1h2tc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2tc1 a.118.1.14 (C:29-290) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
dhleslickvgeksacslesnleglagvleadlpnykskilrllctvarllpekltiytt
lvgllnarnynfggefveamirqlkeslkannyneavylvrflsdlvnchviaapsmvam
fenfvsvtqeedvpqvrrdwyvyaflsslpwvgkelyekkdaemdrifantesylkrrqk
thvpmlqvwtadkphpqeeyldclwaqiqklkkdrwqerhilrpylafdsilcealqhnl
ppftppphtedsvypmprvifr

SCOPe Domain Coordinates for d1h2tc1:

Click to download the PDB-style file with coordinates for d1h2tc1.
(The format of our PDB-style files is described here.)

Timeline for d1h2tc1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h2tz_