Lineage for d1h28d1 (1h28 D:175-309)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331205Protein Cyclin A [47956] (2 species)
  7. 2331247Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
    Uniprot P20248 175-432
  8. 2331558Domain d1h28d1: 1h28 D:175-309 [76544]
    Other proteins in same PDB: d1h28a1, d1h28a2, d1h28c1, d1h28c2

Details for d1h28d1

PDB Entry: 1h28 (more details), 2.8 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p107
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d1h28d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h28d1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOPe Domain Coordinates for d1h28d1:

Click to download the PDB-style file with coordinates for d1h28d1.
(The format of our PDB-style files is described here.)

Timeline for d1h28d1: