SCOP 1.63: Domain d1h1sb2: 1h1s B:310-432

Lineage for d1h1sb2 (1h1s B:310-432)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (16 PDB entries)

8. Domain d1h1sb2: 1h1s B:310-432 [76497]
   Other proteins in same PDB: d1h1sa_, d1h1sc_

Details for d1h1sb2

PDB Entry: 1h1s, 2 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu6102

SCOP Domain Sequences for d1h1sb2:

Sequence; same for both SEQRES and ATOM records:

>d1h1sb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1h1sb2:

• d1h1sb2 is new in SCOP 1.63
  
• d1h1sb2 appears in SCOP 1.65
  
• d1h1sb2 appears in the current release, SCOPe 2.08