|  | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) | 
|  | Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon | 
|  | Superfamily d.6.1: Prion-like [54098] (1 family)  | 
|  | Family d.6.1.1: Prion-like [54099] (3 proteins) | 
|  | Protein Prion protein domain [54100] (14 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [54103] (18 PDB entries) | 
|  | Domain d1h0la_: 1h0l A: [76441] | 
PDB Entry: 1h0l (more details)
SCOPe Domain Sequences for d1h0la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0la_ d.6.1.1 (A:) Prion protein domain {Human (Homo sapiens) [TaxId: 9606]}
gsvvgglggymlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpcdeysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcitqyercsqayyqrgs
Timeline for d1h0la_: