Lineage for d1gz5c_ (1gz5 C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1183918Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1183919Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) (S)
  5. 1184248Family c.87.1.6: Trehalose-6-phosphate synthase, OtsA [82540] (2 proteins)
    family 20 glycosyltransferase; good structural similarity in the active site to the Oligosaccharide phosphorylases
  6. 1184249Protein Trehalose-6-phosphate synthase, OtsA [82541] (1 species)
  7. 1184250Species Escherichia coli [TaxId:562] [82542] (3 PDB entries)
  8. 1184257Domain d1gz5c_: 1gz5 C: [76408]
    complexed with g6p, imd, udp

Details for d1gz5c_

PDB Entry: 1gz5 (more details), 2.43 Å

PDB Description: trehalose-6-phosphate synthase. otsa
PDB Compounds: (C:) alpha-trehalose-phosphate synthase

SCOPe Domain Sequences for d1gz5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gz5c_ c.87.1.6 (C:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]}
srlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgni
twasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpll
qdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdyd
llgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagpl
ppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsr
gdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplr
dgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmsl
aerisrhaemldvivkndinhwqecfisdlkqivpr

SCOPe Domain Coordinates for d1gz5c_:

Click to download the PDB-style file with coordinates for d1gz5c_.
(The format of our PDB-style files is described here.)

Timeline for d1gz5c_: