SCOP 1.65: Domain d1gwbb_: 1gwb B:

Lineage for d1gwbb_ (1gwb B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N

4. Superfamily c.10.2: L domain-like [52058] (8 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (2 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (6 PDB entries)

8. Domain d1gwbb_: 1gwb B: [76363]
   complexed with acy, nag, ndg, pt, so4, sty

Details for d1gwbb_

PDB Entry: 1gwb, 2.8 Å

PDB Description: structure of glycoprotein 1b

SCOP Domain Sequences for d1gwbb_:

Sequence; same for both SEQRES and ATOM records:

>d1gwbb_ c.10.2.7 (B:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens)}
picevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltqln
ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr
glgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllqe
nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamts
nvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyyp

Timeline for d1gwbb_:

• d1gwbb_ first appeared in SCOP 1.63
  
• d1gwbb_ appears in SCOP 1.67
  
• d1gwbb_ appears in the current release, SCOPe 2.08