Lineage for d1gwbb_ (1gwb B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240418Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 240457Superfamily c.10.2: L domain-like [52058] (7 families) (S)
    less regular structure consisting of variable repeats
  5. 240529Family c.10.2.7: von Willebrand factor binding domain of glycoprotein Ib alpha [75142] (1 protein)
    this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain
  6. 240530Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)
  7. 240531Species Human (Homo sapiens) [TaxId:9606] [75144] (3 PDB entries)
  8. 240535Domain d1gwbb_: 1gwb B: [76363]
    complexed with acy, nag, ndg, pt, so4, sty

Details for d1gwbb_

PDB Entry: 1gwb (more details), 2.8 Å

PDB Description: structure of glycoprotein 1b

SCOP Domain Sequences for d1gwbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwbb_ c.10.2.7 (B:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens)}
picevskvashlevncdkrnltalppdlpkdttilhlsenllytfslatlmpytrltqln
ldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgalr
glgelqelylkgnelktlppglltptpkleklslannnltelpagllnglenldtlllqe
nslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamts
nvasvqcdnsdkfpvykypgkgcptlgdegdtdlydyyp

SCOP Domain Coordinates for d1gwbb_:

Click to download the PDB-style file with coordinates for d1gwbb_.
(The format of our PDB-style files is described here.)

Timeline for d1gwbb_: