SCOPe 2.07: Domain d1gszc2: 1gsz C:37-307

Lineage for d1gszc2 (1gsz C:37-307)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.2: Terpene synthases [48243] (2 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Squalene-hopene cyclase [48244] (1 species)

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)

8. Domain d1gszc2: 1gsz C:37-307 [76334]
   complexed with c8e, r71

Details for d1gszc2

PDB Entry: 1gsz, 2.8 Å

PDB Description: crystal structure of a squalene cyclase in complex with the potential anticholesteremic drug ro48-8071

PDB Compounds: (C:) squalene--hopene cyclase

SCOPe Domain Sequences for d1gszc2:

Sequence; same for both SEQRES and ATOM records:

>d1gszc2 a.102.4.2 (C:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
lsnvtmeaeyvllchildrvdrdrmekirryllheqredgtwalypggppdldttieayv
alkyigmsrdeepmqkalrfiqsqggiessrvftrmwlalvgeypwekvpmvppeimflg
krmplniyefgswaratvvalsivmsrqpvfplperarvpelyetdvpprrrgakggggw
ifdaldralhgyqklsvhpfrraaeiraldwllerqagdgswggiqppwfyalialkild
mtqhpafikgweglelygveldyggwmfqas

Timeline for d1gszc2:

• d1gszc2 first appeared in SCOP 1.63
  
• d1gszc2 appears in SCOPe 2.06
  
• d1gszc2 appears in the current release, SCOPe 2.08