Class a: All alpha proteins [46456] (285 folds) |
Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein) |
Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [81765] (1 PDB entry) |
Domain d1gs0a1: 1gs0 A:207-340 [76323] Other proteins in same PDB: d1gs0a2, d1gs0b2 |
PDB Entry: 1gs0 (more details), 2.8 Å
SCOPe Domain Sequences for d1gs0a1:
Sequence, based on SEQRES records: (download)
>d1gs0a1 a.41.1.1 (A:207-340) Domain of poly(ADP-ribose) polymerase {Mouse (Mus musculus) [TaxId: 10090]} esqldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcir agqhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkse rqglehpldqhyrn
>d1gs0a1 a.41.1.1 (A:207-340) Domain of poly(ADP-ribose) polymerase {Mouse (Mus musculus) [TaxId: 10090]} esqldlrvqellklicnvqtmeemmiemkydtkraplgkltvaqikagyqslkkiedcir agqhgralveacnefytriphdfglsippvirtekelsdkvkllealgdieialklvkeh pldqhyrn
Timeline for d1gs0a1: