![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) ![]() |
![]() | Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
![]() | Protein Type II 3-dehydroquinate dehydratase [52306] (6 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry) |
![]() | Domain d1gqou_: 1gqo U: [76315] complexed with gol |
PDB Entry: 1gqo (more details), 2.1 Å
SCOPe Domain Sequences for d1gqou_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqou_ c.23.13.1 (U:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis [TaxId: 1423]} phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak gqivglgaegyklavryllsqq
Timeline for d1gqou_: