Lineage for d1gqog_ (1gqo G:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692549Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 692550Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 692551Protein Type II 3-dehydroquinate dehydratase [52306] (5 species)
  7. 692565Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)
  8. 692572Domain d1gqog_: 1gqo G: [76301]

Details for d1gqog_

PDB Entry: 1gqo (more details), 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis
PDB Compounds: (G:) dehydroquinase

SCOP Domain Sequences for d1gqog_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqog_ c.23.13.1 (G:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis [TaxId: 1423]}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsq

SCOP Domain Coordinates for d1gqog_:

Click to download the PDB-style file with coordinates for d1gqog_.
(The format of our PDB-style files is described here.)

Timeline for d1gqog_: