SCOP 1.63: Domain d1gqog_: 1gqo G:

Lineage for d1gqog_ (1gqo G:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)

6. Protein Type II 3-dehydroquinate dehydratase [52306] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [82349] (1 PDB entry)

8. Domain d1gqog_: 1gqo G: [76301]

Details for d1gqog_

PDB Entry: 1gqo, 2.1 Å

PDB Description: type ii dehydroquinase from bacillus subtilis

SCOP Domain Sequences for d1gqog_:

Sequence; same for both SEQRES and ATOM records:

>d1gqog_ c.23.13.1 (G:) Type II 3-dehydroquinate dehydratase {Bacillus subtilis}
phflilngpnvnrlgsrepevfgrqtltdietdlfqfaealhiqltffqsnhegdlidai
heaeeqysgivlnpgalshysyairdavssislpvvevhlsnlyareefrhqsviapvak
gqivglgaegyklavryllsq

Timeline for d1gqog_:

• d1gqog_ is new in SCOP 1.63
  
• d1gqog_ appears in SCOP 1.65
  
• d1gqog_ appears in the current release, SCOPe 2.08