Lineage for d1giqa1 (1giq A:3-209)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000475Protein Enzymatic component (Ia) of iota-toxin [82812] (1 species)
    mammalian-targeted relative of VIP2; C-terminal domain is catalytic, N-terminal domain interacts with Ib (binding component)
  7. 3000476Species Clostridium perfringens [TaxId:1502] [82813] (3 PDB entries)
  8. 3000477Domain d1giqa1: 1giq A:3-209 [76224]
    complexed with nai

Details for d1giqa1

PDB Entry: 1giq (more details), 1.8 Å

PDB Description: crystal structure of the enzymatic componet of iota-toxin from clostridium perfringens with nadh
PDB Compounds: (A:) Iota toxin component Ia

SCOPe Domain Sequences for d1giqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1giqa1 d.166.1.1 (A:3-209) Enzymatic component (Ia) of iota-toxin {Clostridium perfringens [TaxId: 1502]}
ierpedflkdkenaiqwekkeaerveknldtlekealelykkdseqisnysqtrqyfydy
qiesnprekeyknlrnaisknkidkpinvyyfespekfafnkeirtenqneislekfnel
ketiqdklfkqdgfkdvslyepgngdekptpllihlklpkntgmlpyinsndvktlieqd
ysikidkivriviegkqyikaeasivn

SCOPe Domain Coordinates for d1giqa1:

Click to download the PDB-style file with coordinates for d1giqa1.
(The format of our PDB-style files is described here.)

Timeline for d1giqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1giqa2