SCOPe 2.06: Domain d1g9da1: 1g9d A:862-1079

Lineage for d1g9da1 (1g9d A:862-1079)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
   automatically mapped to Pfam PF07953

6. Protein Botulinum neurotoxin [49959] (2 species)

7. Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (14 PDB entries)

8. Domain d1g9da1: 1g9d A:862-1079 [76212]
   Other proteins in same PDB: d1g9da2, d1g9da3, d1g9da4
   complexed with bab, zn

Details for d1g9da1

PDB Entry: 1g9d, 2.2 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with an inhibitor (experiment 2)

PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1g9da1:

Sequence; same for both SEQRES and ATOM records:

>d1g9da1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

Timeline for d1g9da1:

• d1g9da1 first appeared in SCOP 1.63
  
• d1g9da1 appears in SCOPe 2.05
  
• d1g9da1 appears in SCOPe 2.07
  
• d1g9da1 appears in the current release, SCOPe 2.08