Lineage for d1ffpa1 (1ffp A:182-274)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1759808Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1760095Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
    Uniprot P01901 22-299
  8. 1760208Domain d1ffpa1: 1ffp A:182-274 [76177]
    Other proteins in same PDB: d1ffpa2, d1ffpb_, d1ffpd2, d1ffpe_

Details for d1ffpa1

PDB Entry: 1ffp (more details), 2.6 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
PDB Compounds: (A:) h-2 class I histocompatibility antigen, d-b, alpha chain

SCOPe Domain Sequences for d1ffpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffpa1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOPe Domain Coordinates for d1ffpa1:

Click to download the PDB-style file with coordinates for d1ffpa1.
(The format of our PDB-style files is described here.)

Timeline for d1ffpa1: