Lineage for d1ffoe_ (1ffo E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1513477Protein beta2-microglobulin [88600] (5 species)
  7. 1514079Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries)
    Uniprot P01887
  8. 1514271Domain d1ffoe_: 1ffo E: [76176]
    Other proteins in same PDB: d1ffoa1, d1ffoa2, d1ffod1, d1ffod2

Details for d1ffoe_

PDB Entry: 1ffo (more details), 2.65 Å

PDB Description: crystal structure of murine class i h-2db complexed with synthetic peptide gp33 (c9m/k1a)
PDB Compounds: (E:) beta-2 microglobulin beta chain

SCOPe Domain Sequences for d1ffoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffoe_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1ffoe_:

Click to download the PDB-style file with coordinates for d1ffoe_.
(The format of our PDB-style files is described here.)

Timeline for d1ffoe_: