Lineage for d1eaob_ (1eao B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 291903Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 292069Superfamily b.2.5: p53-like transcription factors [49417] (6 families) (S)
  5. 292154Family b.2.5.6: RUNT domain [81318] (1 protein)
  6. 292155Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 292169Species Mouse (Mus musculus) [TaxId:10090] [63684] (6 PDB entries)
    almost identical sequence to the human protein
  8. 292173Domain d1eaob_: 1eao B: [76143]
    complexed with br; mutant

Details for d1eaob_

PDB Entry: 1eao (more details), 1.4 Å

PDB Description: the runx1 runt domain at 1.4a resolution: a structural switch and specifically bound chloride ions modulate dna binding

SCOP Domain Sequences for d1eaob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eaob_ b.2.5.6 (B:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus)}
smvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagn
denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
vdgp

SCOP Domain Coordinates for d1eaob_:

Click to download the PDB-style file with coordinates for d1eaob_.
(The format of our PDB-style files is described here.)

Timeline for d1eaob_: