SCOP 1.63: Domain d1eaob_: 1eao B:

Lineage for d1eaob_ (1eao B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (6 families)

5. Family b.2.5.6: RUNT domain [81318] (1 protein)

6. Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
   synonym: core binding factor alpha, cbfa

7. Species Mouse (Mus musculus) [TaxId:10090] [63684] (6 PDB entries)
   almost identical sequence to the human protein

8. Domain d1eaob_: 1eao B: [76143]
   complexed with br; mutant

Details for d1eaob_

PDB Entry: 1eao, 1.4 Å

PDB Description: the runx1 runt domain at 1.4a resolution: a structural switch and specifically bound chloride ions modulate dna binding

SCOP Domain Sequences for d1eaob_:

Sequence; same for both SEQRES and ATOM records:

>d1eaob_ b.2.5.6 (B:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus)}
smvevladhpgelvrtdspnflssvlpthwrsnktlpiafkvvalgdvpdgtlvtvmagn
denysaelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikit
vdgp

Timeline for d1eaob_:

• d1eaob_ is new in SCOP 1.63
  
• d1eaob_ appears in SCOP 1.65
  
• d1eaob_ appears in the current release, SCOPe 2.08