Lineage for d8icka3 (8ick A:92-148)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737577Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1738431Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1738432Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1738433Protein DNA polymerase beta [81579] (2 species)
  7. 1738434Species Human (Homo sapiens) [TaxId:9606] [81575] (144 PDB entries)
  8. 1738493Domain d8icka3: 8ick A:92-148 [76054]
    Other proteins in same PDB: d8icka1, d8icka4
    protein/DNA complex; complexed with dtp, mn, na

Details for d8icka3

PDB Entry: 8ick (more details), 2.7 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of datp (1 millimolar), mgcl2 (5 millimolar), and mncl2 (5 millimolar)
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d8icka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d8icka3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d8icka3:

Click to download the PDB-style file with coordinates for d8icka3.
(The format of our PDB-style files is described here.)

Timeline for d8icka3: